Recombinant Human S100 Calcium Binding Protein P/S100-P (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 1mM DTT, 0.1M NaCl, 20% Glycerol, pH 8.0 . |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK |
Source: E.coli.
MW :12.56kD.
Recombinant Human S100 Calcium Binding Protein P is produced by our E.coli expression system and the target gene encoding Met1-Lys95 is expressed with a 6His tag at the N-terminus. Protein S100-P (S100P) belongs to the S100 family of Calcium-Binding Proteins. S100P is 95 amino acids in length and it contains 2 EF-Hand Calcium-Binding Motifs. The EF-Hand Motif binds calcium, which likely alters molecular conformation. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells and it is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. In addition to binding Ca, S100P also binds Zn and Mg, and may play a role in the etiology of prostate cancer.
MW :12.56kD.
Recombinant Human S100 Calcium Binding Protein P is produced by our E.coli expression system and the target gene encoding Met1-Lys95 is expressed with a 6His tag at the N-terminus. Protein S100-P (S100P) belongs to the S100 family of Calcium-Binding Proteins. S100P is 95 amino acids in length and it contains 2 EF-Hand Calcium-Binding Motifs. The EF-Hand Motif binds calcium, which likely alters molecular conformation. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells and it is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. In addition to binding Ca, S100P also binds Zn and Mg, and may play a role in the etiology of prostate cancer.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm, Cell projection |
| Tissue Specificity: | Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial neoplasias. |
| BioGrid: | 112194. 23 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
