Recombinant Human Reticulocalbin-3/RCN3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,1mM DTT,10%Glycerol,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDELVDHHHHHH |
Source: Human Cells.
MW :36.2kD.
Recombinant Human Reticulocalbin-3 is produced by our Mammalian expression system and the target gene encoding Lys21-Leu328 is expressed with a 6His tag at the C-terminus. Reticulocalbin-3 is a member of the CREC family that is involved in the secretory pathway. Members of the CREC family consist of a number of multiple EF-hand domains. Reticulocalbin-3 localizes to the endoplasmic reticulum lumen. The bioinformaticanalysis of Reticulocalbin-3 reveal that it is a putative Ca2+-binding protein. In addition, it has been shown that autoactivation and secretion of PACE4 was increased upon co-expression with Reticulocalbin-3. The proPACE4-RCN-3 complex is plays an important role in the biosynthesis of PACE4.
MW :36.2kD.
Recombinant Human Reticulocalbin-3 is produced by our Mammalian expression system and the target gene encoding Lys21-Leu328 is expressed with a 6His tag at the C-terminus. Reticulocalbin-3 is a member of the CREC family that is involved in the secretory pathway. Members of the CREC family consist of a number of multiple EF-hand domains. Reticulocalbin-3 localizes to the endoplasmic reticulum lumen. The bioinformaticanalysis of Reticulocalbin-3 reveal that it is a putative Ca2+-binding protein. In addition, it has been shown that autoactivation and secretion of PACE4 was increased upon co-expression with Reticulocalbin-3. The proPACE4-RCN-3 complex is plays an important role in the biosynthesis of PACE4.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum lumen |
| BioGrid: | 121488. 9 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
