Recombinant Human Retbindin/RTBDN (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGPVDHHHHHH |
Source: Human Cells.
MW :22.3kD.
Recombinant Human Retbindin is produced by our Mammalian expression system and the target gene encoding Ser31-Pro229 is expressed with a 6His tag at the C-terminus. Human Retbindin is a 229 amino acid secreted protein that belongs to the folate receptor family. The gene that encodes retbindin exists as two alternatively spliced isoforms. Retbindin is first expressed in retina. It may play a role in binding retinoids and other carotenoids as it shares homology with;riboflavin binding proteins. RTBDN gene was first identified in a study of human eye tissues.
MW :22.3kD.
Recombinant Human Retbindin is produced by our Mammalian expression system and the target gene encoding Ser31-Pro229 is expressed with a 6His tag at the C-terminus. Human Retbindin is a 229 amino acid secreted protein that belongs to the folate receptor family. The gene that encodes retbindin exists as two alternatively spliced isoforms. Retbindin is first expressed in retina. It may play a role in binding retinoids and other carotenoids as it shares homology with;riboflavin binding proteins. RTBDN gene was first identified in a study of human eye tissues.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted, Cell membrane |
Post transnational modification: | Not N-glycosylated. |
Tissue Specificity: | Expressed in peripheral retina (at protein level). |
BioGrid: | 123678. 9 interactions. |
There are currently no product reviews
|