Recombinant Human Regenerating Islet-Derived Protein 3-gamma /Reg3 gamma /REG3G (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKDVDHHHHHH |
Source: Human Cells.
MW :17.5kD.
Recombinant Human Regenerating islet-derived protein 3-gamma is produced by our Mammalian expression system and the target gene encoding Glu27-Asp175 is expressed with a 6His tag at the C-terminus. Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma, is a secreted protein which contains 1 C-type lectin domain. It is expressed almost exclusively in the pancreas and also expressed in testis, but not found in small intestine. This protein might be a stress protein involved in the control of bacterial proliferation.
MW :17.5kD.
Recombinant Human Regenerating islet-derived protein 3-gamma is produced by our Mammalian expression system and the target gene encoding Glu27-Asp175 is expressed with a 6His tag at the C-terminus. Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma, is a secreted protein which contains 1 C-type lectin domain. It is expressed almost exclusively in the pancreas and also expressed in testis, but not found in small intestine. This protein might be a stress protein involved in the control of bacterial proliferation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Cytoplasm |
| Post transnational modification: | Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity. |
| Tissue Specificity: | Predominantly expressed in pancreas, where it may be restricted to exocrine pancreas. Moderate expression levels in testis and weak in heart, kidney and placenta. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
