Recombinant Human Regenerating Islet-Derived Protein 1-a/REG1A (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH |
Source: Human Cells.
MW :17.31kD.
Recombinant Human Regenerating Islet-Derived Protein 1-alpha is produced by our Mammalian expression system and the target gene encoding Gln23-Asn166 is expressed with a 6His tag at the C-terminus. Regenerating Islet-Derived Protein 1-a (REG1A) belongs to the Reg family of secreted proteins with a C-type lectic domain. REG1A is highly expressed levels in fetal and infant brains, much lower in adult brains. REG1A promotes the maintenance and growth of pancreatic islet cells and intestinal villi. In addition to, REG1A Might act as an inhibitor of spontaneous calcium carbonate precipitation and be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
MW :17.31kD.
Recombinant Human Regenerating Islet-Derived Protein 1-alpha is produced by our Mammalian expression system and the target gene encoding Gln23-Asn166 is expressed with a 6His tag at the C-terminus. Regenerating Islet-Derived Protein 1-a (REG1A) belongs to the Reg family of secreted proteins with a C-type lectic domain. REG1A is highly expressed levels in fetal and infant brains, much lower in adult brains. REG1A promotes the maintenance and growth of pancreatic islet cells and intestinal villi. In addition to, REG1A Might act as an inhibitor of spontaneous calcium carbonate precipitation and be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The composition of the O-linked carbohydrate on Thr-27 is complex and varied. In the crystallographic structure, the attached sugar appears to be N-acetylglucosamine, typical of an intracellular protein, rather than N-acetylgalactosamine. |
| Tissue Specificity: | In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients. |
| BioGrid: | 111899. 6 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
