Recombinant Human PRV1/CD177(C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGVDHHHHHH |
Source: Human Cells.
MW :42.33kD.
Recombinant Human CD177 is produced by our Mammalian expression system and the target gene encoding Leu22-Gly407 is expressed with a 6His tag at the C-terminus. CD177 is polymorphic and has at least two alleles: PRV1 and NB1. Human PRV1 is a Glycosyl-Phosphatidylinositol (GPI)-linked cell surface glycoprotein that belongs to the uPAR/CD59/Ly6 family of receptors. PRV1 is expressed by neutrophils and neutrophil precursors,and changes in expression serve as diagnostic markers for myeloproliferative disorders such as polycythemia vera and essential thrombocythemia. PRV1 may also be expressed by Erythroblasts, B cells, and Monocytes. NB1, a Glycosyl-Phosphatidylinositol (GPI)-linked cell surface glycoprotein, was first described in a case of neonatal alloimmune neutropenia. It is reported that CD177 functions as a novel heterophilic binding partner that engages PECAM-1 in membrane-proximal IgD6.
MW :42.33kD.
Recombinant Human CD177 is produced by our Mammalian expression system and the target gene encoding Leu22-Gly407 is expressed with a 6His tag at the C-terminus. CD177 is polymorphic and has at least two alleles: PRV1 and NB1. Human PRV1 is a Glycosyl-Phosphatidylinositol (GPI)-linked cell surface glycoprotein that belongs to the uPAR/CD59/Ly6 family of receptors. PRV1 is expressed by neutrophils and neutrophil precursors,and changes in expression serve as diagnostic markers for myeloproliferative disorders such as polycythemia vera and essential thrombocythemia. PRV1 may also be expressed by Erythroblasts, B cells, and Monocytes. NB1, a Glycosyl-Phosphatidylinositol (GPI)-linked cell surface glycoprotein, was first described in a case of neonatal alloimmune neutropenia. It is reported that CD177 functions as a novel heterophilic binding partner that engages PECAM-1 in membrane-proximal IgD6.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Membrane raft, Secreted, Cytoplasmic granule membrane, Cell projection |
| Post transnational modification: | A soluble form may also be produced by proteolytic cleavage at the cell surface (shedding). |
| Tissue Specificity: | Highly expressed in normal bone marrow and weakly expressed in fetal liver (PubMed:10753836). During neutrophil differentiation, expression begins at the metamyelocyte stage and continues throughout the subsequent stages (at protein level) (PubMed:17244676, PubMed:18462208, PubMed:24926686). Expressed by a subset of mature neutrophils (at protein level) (PubMed:10753836, PubMed:28240246, PubMed:12377969, PubMed:18462208, PubMed:12675722, PubMed:17244676, PubMed:17580308, PubMed:21193407, PubMed:24926686, PubMed:28807980, PubMed:27227454). The percentage of neutrophils expressing CD177 varies across the population (PubMed:17244676, PubMed:27227454). Expressed in granulocytes of patients with polycythemia vera (PV) and with essential thrombocythemia (ET) (PubMed:10753836, PubMed:12377969). |
| BioGrid: | 121389. 3 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
