Recombinant Human Protein Phosphatase 1G/PP1MG (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 25mM TrisHCl, 1mM DTT, 1mM EDTA, 2mM beta-ME, 20% Glycerol, pH 7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRDLEHHHHHH |
Source: E.coli.
MW :26.15kD.
Recombinant Human PP1MG is produced by our E.coli expression system and the target gene encoding Met317-Asp546 is expressed with a 6His tag at the C-terminus. Protein Phosphatase 1G (PP1MG) is a cytoplasmic protein that belongs to the PP2C family. PPM1G is widely expressed; it is abundant in testis, skeletal muscle, and heart. PPM1G is a negative regulator of cell stress response pathways. PPM1G is responsible for the dephosphorylation of Pre-mRNA splicing factors, an important factor for the formation of functional spliceosome. PPM1G also plays a role in regulating cell cycle progression.
MW :26.15kD.
Recombinant Human PP1MG is produced by our E.coli expression system and the target gene encoding Met317-Asp546 is expressed with a 6His tag at the C-terminus. Protein Phosphatase 1G (PP1MG) is a cytoplasmic protein that belongs to the PP2C family. PPM1G is widely expressed; it is abundant in testis, skeletal muscle, and heart. PPM1G is a negative regulator of cell stress response pathways. PPM1G is responsible for the dephosphorylation of Pre-mRNA splicing factors, an important factor for the formation of functional spliceosome. PPM1G also plays a role in regulating cell cycle progression.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Membrane |
| Tissue Specificity: | Widely expressed. Most abundant in testis, skeletal muscle, and heart. |
| BioGrid: | 111491. 110 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
