Recombinant Human Protein CutA (C-6His)

Product code: 32-7233

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $413.00 

  • $679.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
Gene : CUTA
Gene ID : 51596
Uniprot ID : O60888
Source: E.coli.
MW :17.9kD.
Recombinant Human Protein CutA is produced by our E.coli expression system and the target gene encoding Met1-Pro156 is expressed with a 6His tag at the C-terminus. Protein CutA (CUTA) posseses a signal peptide and is widely expressed in brain. CUTA mayforms part of a complex of membrane proteins attached to acetylcholinesterase (AChE). CUTA takes part in cellular tolerance to a broad range of divalent cations other than copper. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Post transnational modification: O-glycosylated.
Tissue Specificity: Ubiquitous. Widely expressed in brain.
BioGrid: 119628. 24 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products