Recombinant Human Prostate-Specific Antigen//PSA/KLK3 (Ile25-Pro261, C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHcl, 150mM NaCl,1mM CaCl2,pH7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHHHH |
Source: Human Cells.
MW :27.1kD.
Recombinant Human KLK3 is produced by our Mammalian expression system and the target gene encoding Ile25-Pro261 is expressed with a 6His tag at the C-terminus. KLK3, also known as APS, is short for Prostate-specific antigen. It is a 261 aa. protein which belongs to the peptidase S1 family and Kallikrein subfamily. This protein has 5 isforms produced by alternative splicing. It is a secreted protein and can forms a heterodimer with SERPINA5 which can inhibit its activity. KLK3 is also strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders. KLK3 can hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
MW :27.1kD.
Recombinant Human KLK3 is produced by our Mammalian expression system and the target gene encoding Ile25-Pro261 is expressed with a 6His tag at the C-terminus. KLK3, also known as APS, is short for Prostate-specific antigen. It is a 261 aa. protein which belongs to the peptidase S1 family and Kallikrein subfamily. This protein has 5 isforms produced by alternative splicing. It is a secreted protein and can forms a heterodimer with SERPINA5 which can inhibit its activity. KLK3 is also strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders. KLK3 can hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 106850. 9 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
