Recombinant Human Pro-Cathepsin H/CTSH (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AELSVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLVVDHHHHHH |
Source: Human Cells.
MW :36.19kD.
Recombinant Human Cathepsin H is produced by our Mammalian expression system and the target gene encoding Ala23-Val335 is expressed with a 6His tag at the C-terminus. Pro-Cathepsin H (CTSH) is a lysosomal cysteine proteinase that belongs to the peptidase C1 family. CTSH is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. CTSH is important for the overall degradation of proteins in lysosomes. CTSH hydrolyzes lysosomal proteins, acting as an aminopeptidase (notably, cleaving Arg-|-Xaa bonds) as well as an endopeptidase. Increased expression of CTSH has been correlated with malignant progression of prostate tumors.
MW :36.19kD.
Recombinant Human Cathepsin H is produced by our Mammalian expression system and the target gene encoding Ala23-Val335 is expressed with a 6His tag at the C-terminus. Pro-Cathepsin H (CTSH) is a lysosomal cysteine proteinase that belongs to the peptidase C1 family. CTSH is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. CTSH is important for the overall degradation of proteins in lysosomes. CTSH hydrolyzes lysosomal proteins, acting as an aminopeptidase (notably, cleaving Arg-|-Xaa bonds) as well as an endopeptidase. Increased expression of CTSH has been correlated with malignant progression of prostate tumors.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Lysosome |
| BioGrid: | 107892. 21 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
