Recombinant Human Plasma Kallikrein/KLKB1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol,pH8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPAVDHHHHHH |
Source: Human Cells.
MW :70.2kD.
Recombinant Human Plasma kallikrein is produced by our Mammalian expression system and the target gene encoding Gly20-Ala638 is expressed with a 6His tag at the C-terminus. KLKB1 is a 638 amino acids protein that belongs to the peptidase S1 family and plasma kallikrein subfamily. It contains a peptidase S1 domain and four apple domains. The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. It participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation.Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.
MW :70.2kD.
Recombinant Human Plasma kallikrein is produced by our Mammalian expression system and the target gene encoding Gly20-Ala638 is expressed with a 6His tag at the C-terminus. KLKB1 is a 638 amino acids protein that belongs to the peptidase S1 family and plasma kallikrein subfamily. It contains a peptidase S1 domain and four apple domains. The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. It participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation.Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 110018. 6 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
