Recombinant Human Placental Lactogen/CSH1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFVDHHHHHH |
Source: Human Cells.
MW :23.35kD.
Recombinant Human Placental Lactogen is produced by our Mammalian expression system and the target gene encoding Val27-Phe217 is expressed with a 6His tag at the C-terminus. Chorionic Somatomammotropin Hormone (CSH1) belongs to the Somatotropin/Prolactin family. It is located at the growth hormone locus on chromosome 17. It is produced by cells in the syncytiotrophoblast layer of the placenta only during pregnancy. Although CSH1 does not interact with GHR but only activates PRLR through zinc-induced dimerization. It is expressed mainly in the placenta and utilizes multiple transcription initiation sites. CSH1 plays an important role in stimulating lactation, growth control and metabolism.
MW :23.35kD.
Recombinant Human Placental Lactogen is produced by our Mammalian expression system and the target gene encoding Val27-Phe217 is expressed with a 6His tag at the C-terminus. Chorionic Somatomammotropin Hormone (CSH1) belongs to the Somatotropin/Prolactin family. It is located at the growth hormone locus on chromosome 17. It is produced by cells in the syncytiotrophoblast layer of the placenta only during pregnancy. Although CSH1 does not interact with GHR but only activates PRLR through zinc-induced dimerization. It is expressed mainly in the placenta and utilizes multiple transcription initiation sites. CSH1 plays an important role in stimulating lactation, growth control and metabolism.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 107829. 8 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
