Recombinant Human PLA2G1B/PLA2/PLA2A (C-6His)(Discontinued)

Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol,pH8.0. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQSVDHHHHHH |
Source: Human Cells.
MW :15.2kD.
Recombinant Human PLA2G1B is produced by our Mammalian expression system and the target gene encoding Ala23-Ser148 is expressed with a 6His tag at the C-terminus. Phospholipase A2(PLA2G1B) is a secreted protein which belongs to the phospholipase A2 family. It catalyzes the release of fatty acids from glycero-3-phosphocholines. It catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules. Sequences of pancreatic PLA2G1B enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Mice lacking in PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. Oral supplementation of a diabetogenic diet with the PLA2G1B inhibitor methyl indoxam effectively suppresses diet-induced obesity and diabetes. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.
MW :15.2kD.
Recombinant Human PLA2G1B is produced by our Mammalian expression system and the target gene encoding Ala23-Ser148 is expressed with a 6His tag at the C-terminus. Phospholipase A2(PLA2G1B) is a secreted protein which belongs to the phospholipase A2 family. It catalyzes the release of fatty acids from glycero-3-phosphocholines. It catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules. Sequences of pancreatic PLA2G1B enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Mice lacking in PLA2G1B are resistant to obesity and diabetes induced by feeding a diabetogenic high-fat/high-carbohydrate diet. Oral supplementation of a diabetogenic diet with the PLA2G1B inhibitor methyl indoxam effectively suppresses diet-induced obesity and diabetes. PLA2G1B inhibition may be a potentially effective oral therapeutic option for treatment of obesity and diabetes.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically. |
BioGrid: | 111336. 2 interactions. |
There are currently no product reviews
|