-->

Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1/PPIase/PPIL1(N-6His)

Product code: 32-7269

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $413.00 

  • $679.00 

-->

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, pH 8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MGSSHHHHHHSSGLVPRGSHMAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Gene : PPIL1
Gene ID : 51645
Uniprot ID : Q9Y3C6
Source: E.coli.
MW :20.4kD.
Recombinant Human PPIase is produced by our E.coli expression system and the target gene encoding Met1-Gly166 is expressed with a 6His tag at the N-terminus. Peptidyl-Prolyl Cis-Trans Isomerase-Like 1 (PPIase) belongs to the cyclophilin-type PPIase family. PPIases can accelerate the folding of proteins and catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIase is a ubiquitous protein and has highly expression in heart ,skeletal and muscle. PPIase contains a PPIase cyclophilin-type domain and four Cyclosporin A binding regions. PPIase might play an important role in proliferation of cancer cells through modulation of phosphorylation of stathmin. It is suggested that PPIase can act as as a novel molecular target for colon-cancer therapy.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Tissue Specificity: Ubiquitous, with the most abundant expression in heart and skeletal muscle.
BioGrid: 119654. 31 interactions.
There are currently no product reviews