Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2/FKBP22/FKBP13 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mm NaCl,pH7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELVDHHHHHH |
Source: Human Cells.
MW :14.3kD.
Recombinant Human PPIase FKBP2 is produced by our Mammalian expression system and the target gene encoding Ala22-Leu142 is expressed with a 6His tag at the C-terminus. Peptidyl-prolyl cis-trans isomerase FKBP2(FKBP2 for short), also named 13 kDa FK506-binding protein, FK506-binding protein 2, Immunophilin FKBP13, Rotamase, is a endoplasmic reticulum peripheral membrane protein. It contains 1 PPIase FKBP-type domain and belongs to the FKBP-type PPIase family, FKBP2 subfamily which takes part in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP2 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. FKBP2 functions as an ER chaperone and as a component of membrane cytoskeletal scaffolds.
MW :14.3kD.
Recombinant Human PPIase FKBP2 is produced by our Mammalian expression system and the target gene encoding Ala22-Leu142 is expressed with a 6His tag at the C-terminus. Peptidyl-prolyl cis-trans isomerase FKBP2(FKBP2 for short), also named 13 kDa FK506-binding protein, FK506-binding protein 2, Immunophilin FKBP13, Rotamase, is a endoplasmic reticulum peripheral membrane protein. It contains 1 PPIase FKBP-type domain and belongs to the FKBP-type PPIase family, FKBP2 subfamily which takes part in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP2 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. FKBP2 functions as an ER chaperone and as a component of membrane cytoskeletal scaffolds.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum membrane |
| Tissue Specificity: | T-cells and thymus. |
| BioGrid: | 108576. 47 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
