Recombinant Human PDCD5/TFAR19 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY |
Source: E. coli.
MW :16.4kD.
Recombinant Human Programmed Cell Death Protein 5 is produced by our E.coli expression system and the target gene encoding Met1-Tyr125 is expressed with a 6His tag at the N-terminus. Programmed Cell Death Protein 5 (PDCD5) is a member of the PDCD5 family. PDCD5 is expressed in tumor cells during apoptosis, independent of apoptosis-inducing stimuli. This protein may function in the process of apoptosis. PDCD5 is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. PDCD5 may play an important regulator of K (lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. PDCD5 is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death.
MW :16.4kD.
Recombinant Human Programmed Cell Death Protein 5 is produced by our E.coli expression system and the target gene encoding Met1-Tyr125 is expressed with a 6His tag at the N-terminus. Programmed Cell Death Protein 5 (PDCD5) is a member of the PDCD5 family. PDCD5 is expressed in tumor cells during apoptosis, independent of apoptosis-inducing stimuli. This protein may function in the process of apoptosis. PDCD5 is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. PDCD5 may play an important regulator of K (lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. PDCD5 is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Tissue Specificity: | Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta. |
| BioGrid: | 114588. 26 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
