Recombinant Human Parathyroid Hormone-Related Protein/PTHLH (C-6His)(Discontinued)
![](images/categories/discont_prod_icon.jpg)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRLEHHHHHH |
Source: E. coli.
MW :16.9kD.
Recombinant Human Parathyroid Hormone-Related Protein is produced by our E.coli expression system and the target gene encoding Ala37-Arg175 is expressed with a 6His tag at the C-terminus. Parathyroid Hormone-Related protein (PTHRP) is a member of the parathyroid hormone family. PTHRP is known as a potent inhibitor of chondrocyte maturation. PTHRP is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. PTHRP also regulates epithelial-mesenchymal interactions during the formation of the mammary glands. During endochondral bone development, PTHRP plays a major role in suppressing the onset of hypertrophic differentiation. Defects in PTHRP are the cause of Brachydactyly Type E2.
MW :16.9kD.
Recombinant Human Parathyroid Hormone-Related Protein is produced by our E.coli expression system and the target gene encoding Ala37-Arg175 is expressed with a 6His tag at the C-terminus. Parathyroid Hormone-Related protein (PTHRP) is a member of the parathyroid hormone family. PTHRP is known as a potent inhibitor of chondrocyte maturation. PTHRP is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. PTHRP also regulates epithelial-mesenchymal interactions during the formation of the mammary glands. During endochondral bone development, PTHRP plays a major role in suppressing the onset of hypertrophic differentiation. Defects in PTHRP are the cause of Brachydactyly Type E2.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cytoplasm, Nucleus, Secreted |
Post transnational modification: | There are 3 principal secretory forms, called PTHrP[1-36], PTHrP[38-94], and osteostatin (PTHrP[107-139]) arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its own receptors that mediates the normal paracrine, autocrine and endocrine actions. |
Tissue Specificity: | Ubiquitous. Also expressed in the mammary gland. |
BioGrid: | 111716. 5 interactions. |
There are currently no product reviews
|