Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)(Discontinued)
![](images/categories/discont_prod_icon.jpg)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLGVDHHHHHH |
Source: Human Cells.
MW :32.3kD.
Recombinant Human Palmitoyl-protein thioesterase 1 is produced by our Mammalian expression system and the target gene encoding Asp28-Gly306 is expressed with a 6His tag at the C-terminus. Palmitoyl-protein thioesterase 1(PPT-1 for short), also known as Palmitoyl-protein hydrolase 1, belongs to the palmitoyl-protein thioesterase family. It is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. This enzyme removes thioester-linked fatty acyl groups such as palmitate from modified cysteine residues in proteins or peptides during lysosomal degradation. Defects in PPT1 are the cause of neuronal ceroid lipofuscinosis type 1.
MW :32.3kD.
Recombinant Human Palmitoyl-protein thioesterase 1 is produced by our Mammalian expression system and the target gene encoding Asp28-Gly306 is expressed with a 6His tag at the C-terminus. Palmitoyl-protein thioesterase 1(PPT-1 for short), also known as Palmitoyl-protein hydrolase 1, belongs to the palmitoyl-protein thioesterase family. It is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. This enzyme removes thioester-linked fatty acyl groups such as palmitate from modified cysteine residues in proteins or peptides during lysosomal degradation. Defects in PPT1 are the cause of neuronal ceroid lipofuscinosis type 1.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Lysosome, Secreted |
Post transnational modification: | Glycosylated. |
BioGrid: | 111530. 37 interactions. |
There are currently no product reviews
|