Recombinant Human PAF-AH subunit beta/PAFAHB (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIAVEHHHHHH |
Source: E.coli.
MW :26.6kD.
Recombinant Human PAF-AH subunit beta is produced by our E.coli expression system and the target gene encoding Ser2-Ala229 is expressed with a 6His tag at the C-terminus. Platelet-Activating Factor Acetylhydrolase IB Subunit beta (PAFAHB) is a cytoplasmic hydrolase. PAFAHB is a member of the GDSL lipolytic enzyme family. It also belongs to Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma), PAFAHB is a catalytic subunit. PAFAHB inactivates PAF by removing the acetyl group at the sn-2 position.
MW :26.6kD.
Recombinant Human PAF-AH subunit beta is produced by our E.coli expression system and the target gene encoding Ser2-Ala229 is expressed with a 6His tag at the C-terminus. Platelet-Activating Factor Acetylhydrolase IB Subunit beta (PAFAHB) is a cytoplasmic hydrolase. PAFAHB is a member of the GDSL lipolytic enzyme family. It also belongs to Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma), PAFAHB is a catalytic subunit. PAFAHB inactivates PAF by removing the acetyl group at the sn-2 position.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Ubiquitous. |
| BioGrid: | 111086. 54 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
