Recombinant Human OX40 Ligand/TNFSF4/OX40L (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Source: Human Cells.
MW :16.3kD.
Recombinant Human OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 6His tag at the N-terminus. Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein. OX40L is the ligand for CD134 and is expressed on such cells as DC2s enabling amplification of Th2 cell differentiation. It is a cytokine that binds to TNFRSF4, Co-stimulates T-cell proliferation and cytokine production. It has been found association with systemic lupus erythematosus, No association with occurrence of atherosclerosis.
MW :16.3kD.
Recombinant Human OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 6His tag at the N-terminus. Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein. OX40L is the ligand for CD134 and is expressed on such cells as DC2s enabling amplification of Th2 cell differentiation. It is a cytokine that binds to TNFRSF4, Co-stimulates T-cell proliferation and cytokine production. It has been found association with systemic lupus erythematosus, No association with occurrence of atherosclerosis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
