Recombinant Human Omentin/Intelectin-1/ITLN-1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 50mM Tris,100mMNaCl, 5mM GSH, 0.5mM GSSG,pH8.0 . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MNHKVHHHHHHMTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS |
Source: E. coli.
MW :32.7kD.
Recombinant Human Intelectin-1 is produced by our E.coli expression system and the target gene encoding Thr19-Ser298 is expressed with a 6His tag at the N-terminus. Intelectin-1(ITLN1) is a secreted protein and contains 1 fibrinogen C-terminal domain. Intelectin-1 is a 40 kDa Ca-dependent galactofuranose-binding lectin that is not a C-type lectin. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. The protein has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. It increases AKT phosphorylation in the absence and presence of insulin and it may play a role in the defense systemagainst microorganisms. It also may specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosy l residues, in a calcium-dependent manner.
MW :32.7kD.
Recombinant Human Intelectin-1 is produced by our E.coli expression system and the target gene encoding Thr19-Ser298 is expressed with a 6His tag at the N-terminus. Intelectin-1(ITLN1) is a secreted protein and contains 1 fibrinogen C-terminal domain. Intelectin-1 is a 40 kDa Ca-dependent galactofuranose-binding lectin that is not a C-type lectin. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. The protein has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. It increases AKT phosphorylation in the absence and presence of insulin and it may play a role in the defense systemagainst microorganisms. It also may specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosy l residues, in a calcium-dependent manner.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Secreted |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level) (PubMed:16531507). Highly expressed in the small intestine. Also found in the heart, testis, colon, salivary gland, skeletal muscle, pancreas and thyroid and, to a lesser degree, in the uterus, spleen, prostate, lymph node and thymus. |
| BioGrid: | 120741. 14 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
