Recombinant Human Nucleolar Protein Family A Member 2/NHP2/NOLA2 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris,100mM NaCl,1mM DTT, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL |
Source: E. coli.
MW :19.3kD.
Recombinant Human NHP2 is produced by our E.coli expression system and the target gene encoding Met1-Leu153 is expressed with a 6His tag at the N-terminus. NHP2 belongs to the H/ACA snoRNPs gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been organized into 2 families: C/D and H/ACA. NHP2 forms a small ribonucleoprotein particle with GAR1 (NOLA1). NHP2 is involved in a variety of aspects of rRNA processing and modification. NHP2 localizes to the dense fibrillar component of the nucleolus and in nuclear Cajal bodies. NHP2 may also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
MW :19.3kD.
Recombinant Human NHP2 is produced by our E.coli expression system and the target gene encoding Met1-Leu153 is expressed with a 6His tag at the N-terminus. NHP2 belongs to the H/ACA snoRNPs gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been organized into 2 families: C/D and H/ACA. NHP2 forms a small ribonucleoprotein particle with GAR1 (NOLA1). NHP2 is involved in a variety of aspects of rRNA processing and modification. NHP2 localizes to the dense fibrillar component of the nucleolus and in nuclear Cajal bodies. NHP2 may also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Nucleus |
| Tissue Specificity: | Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver. |
| BioGrid: | 120783. 35 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
