Recombinant Human Nucleolar Protein 3/NOL3 (N-GST)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl,350mM NaCl,1mM DTT,pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS |
Source: E.coli.
MW :48.92kD.
Recombinant Human Nucleolar Protein 3 is produced by our E.coli expression system and the target gene encoding Met1-Ser208 is expressed with a GST tag at the N-terminus. Nucleolar Protein 3 is encoded by NOL3 gene; multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53.
MW :48.92kD.
Recombinant Human Nucleolar Protein 3 is produced by our E.coli expression system and the target gene encoding Met1-Ser208 is expressed with a GST tag at the N-terminus. Nucleolar Protein 3 is encoded by NOL3 gene; multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in RNA splicing.Isoform 2 may inhibit apoptosis.It has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Mitochondrion, Sarcoplasmic reticulum, Membrane |
| Post transnational modification: | Polyubiquitinated by MDM2; promoting proteasomal-dependent degradation in response to apoptotic stimuli. |
| Tissue Specificity: | Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas. |
| BioGrid: | 114477. 37 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
