Recombinant Human Nogo-66 Receptor-Related 3/NgR3/RTN4RL1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | CPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAVDHHHHHH |
Source: Human Cells.
MW :45.49kD.
Recombinant Human NgR3 is produced by our Mammalian expression system and the target gene encoding Cys25-Ala419 is expressed with a 6His tag at the C-terminus. Nogo-66 Receptor-Related Protein 3 (NgR3) has primary structures with NgR2 (NgRH1, NgRL3) and biochemical properties that are homologous to Nogo-66 receptor (NgR), and constitute a novel neuronal receptor protein family. NgR is GPI-anchored and contains eight leucine-rich repeats (LRR), it is the neuronal receptor for the myelin- associated proteins Nogo-A, OMgp (oligodendrocyte myelin glycoprotein), and MAG (myelin-associated glycoprotein) and mediates the inhibition of CNS axonal regeneration both in vitro and in vivo. NgR2 and NgR3 have similar structure and distinct but overlapping expression versus NgR. NgR2 can be metalloproteinase-cleaved to release a soluble ectodomain. NgR2 has also been shown to bind MAG, but ligands for NgR3 have not yet been determined. Mature huaman NgR3 shares 88%, 88%, 48% and 44% amino acid identity with mature mouse NgR3, rat NgR3, human NgRH1 and NgR, repectively.
MW :45.49kD.
Recombinant Human NgR3 is produced by our Mammalian expression system and the target gene encoding Cys25-Ala419 is expressed with a 6His tag at the C-terminus. Nogo-66 Receptor-Related Protein 3 (NgR3) has primary structures with NgR2 (NgRH1, NgRL3) and biochemical properties that are homologous to Nogo-66 receptor (NgR), and constitute a novel neuronal receptor protein family. NgR is GPI-anchored and contains eight leucine-rich repeats (LRR), it is the neuronal receptor for the myelin- associated proteins Nogo-A, OMgp (oligodendrocyte myelin glycoprotein), and MAG (myelin-associated glycoprotein) and mediates the inhibition of CNS axonal regeneration both in vitro and in vivo. NgR2 and NgR3 have similar structure and distinct but overlapping expression versus NgR. NgR2 can be metalloproteinase-cleaved to release a soluble ectodomain. NgR2 has also been shown to bind MAG, but ligands for NgR3 have not yet been determined. Mature huaman NgR3 shares 88%, 88%, 48% and 44% amino acid identity with mature mouse NgR3, rat NgR3, human NgRH1 and NgR, repectively.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Membrane raft, Perikaryon, Cell projection |
| Tissue Specificity: | Predominantly expressed in brain. Expressed at lower levels in kidney, lung, mammary gland, placenta, salivary gland, skeletal muscle and spleen. |
| BioGrid: | 127008. 5 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
