Recombinant Human NIP7/KD93 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0 . |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MGSSHHHHHHSSGLVPRGSHMRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT |
Source: E.coli.
MW :22.6kD.
Recombinant Human NIP7 is produced by our E.coli expression system and the target gene encoding Met1-Thr180 is expressed with a 6His tag at the N-terminus. 60S Ribosome Subunit Biogenesis Protein NIP7 Homolog (NIP7) belongs to the NIP7 family. NIP7 contains one PUA domain, it is essential for the process of proper 27S pre-rRNA and 60S ribosome subunit assembly. NIP7 is a monomer form and interacts with NOL8 and SBDS, and may bind to RNA. In addition, NIP7 is one of the many trans-acting factors required for eukaryotic ribosome biogenesis, which interacts with nascent pre-ribosomal particles and dissociates as they complete maturation and are exported to the cytoplasm.
MW :22.6kD.
Recombinant Human NIP7 is produced by our E.coli expression system and the target gene encoding Met1-Thr180 is expressed with a 6His tag at the N-terminus. 60S Ribosome Subunit Biogenesis Protein NIP7 Homolog (NIP7) belongs to the NIP7 family. NIP7 contains one PUA domain, it is essential for the process of proper 27S pre-rRNA and 60S ribosome subunit assembly. NIP7 is a monomer form and interacts with NOL8 and SBDS, and may bind to RNA. In addition, NIP7 is one of the many trans-acting factors required for eukaryotic ribosome biogenesis, which interacts with nascent pre-ribosomal particles and dissociates as they complete maturation and are exported to the cytoplasm.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Nucleus |
Tissue Specificity: | Expressed in hematopoietic stem/progenitor cells. |
BioGrid: | 119517. 35 interactions. |
There are currently no product reviews
|