Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of PBS, 50% glycerol,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVDHHHHHH |
Source: Human Cells.
MW :21.6kD.
Recombinant Human NGAL is produced by our Mammalian expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus. LCN2 is iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. LCN2 binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. LCN2 is involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. LCN2 is involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth.
MW :21.6kD.
Recombinant Human NGAL is produced by our Mammalian expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus. LCN2 is iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. LCN2 binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. LCN2 is involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. LCN2 is involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed in bone marrow and in tissues that are prone to exposure to microorganism. High expression is found in bone marrow as well as in uterus, prostate, salivary gland, stomach, appendix, colon, trachea and lung. Not found in the small intestine or peripheral blood leukocytes. |
| BioGrid: | 110126. 25 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
