Recombinant Human NCR3/NKp30/CD337 (C-Fc)(Discontinued)

Product code: 32-8216

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene : NCR3
Gene ID : 259197
Uniprot ID : O14931
Source: Human Cells.
MW :40.2kD.
Recombinant Human NCR3 is produced by our Mammalian expression system and the target gene encoding Leu19-Thr138 is expressed with a Fc tag at the C-terminus. Natural Cytotoxicity Triggering Receptor 3 (NCR3) along with NKp44 and NKp46 constitute a group of receptors termed “Natural Cytotoxicity Receptors”. They play a major role in triggering NK-mediated killing of most tumor cells lines. NKp30 is a type I transmembrane protein having a single extracellular V-like immunoglobulin domain. NKp30 is selectively expressed both in resting and activated human NK cells. In addition, NKp30 is also involved in NK-mediated induction of dendritic cell (DC) maturation. It has been demonstrated that NK cell activation signaling specifically induces lytic activity against several tumor cell types and synthesis of new NF-?B dependent proteins during the initiation of cytotoxicity.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cell membrane
Tissue Specificity: Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
BioGrid: 129224. 2 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products