Recombinant Human Myelin P2 Protein/PMP2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
Source: E.coli.
MW :17.07kD.
Recombinant Human Myelin P2 protein is produced by our E.coli expression system and the target gene encoding Met1-Val132 is expressed with a 6His tag at the N-terminus. Myelin P2 Protein (PMP2) is a cytoplasmic protein which belongs to the Fatty-acid binding protein (FABP) family of calycin superfamily. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. PMP2 is found in peripheral nerve myelin and spinal cord myelin, the oligodendrocytes and Schwann cells, respectively. PMP2 may be involved in lipid transport protein in Schwann cells. It may decrease the inhibitory effect of T suppressors in the culture of immune lymph node cells.
MW :17.07kD.
Recombinant Human Myelin P2 protein is produced by our E.coli expression system and the target gene encoding Met1-Val132 is expressed with a 6His tag at the N-terminus. Myelin P2 Protein (PMP2) is a cytoplasmic protein which belongs to the Fatty-acid binding protein (FABP) family of calycin superfamily. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. PMP2 is found in peripheral nerve myelin and spinal cord myelin, the oligodendrocytes and Schwann cells, respectively. PMP2 may be involved in lipid transport protein in Schwann cells. It may decrease the inhibitory effect of T suppressors in the culture of immune lymph node cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| BioGrid: | 111388. 7 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
