Recombinant Human Myelin Oligodendrocyte Glycoprotein/MOG (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVDHHHHHH |
Source: Human Cells.
MW :15.31kD.
Recombinant Human Myelin Oligodendrocyte Glycoprotein is produced by our Mammalian expression system and the target gene encoding Gly30-Gly154 is expressed with a 6His tag at the C-terminus. Myelin Oligodendrocyte Glycoprotein (MOG) is a transmembrane protein, which is expressed exclusively in the CNS. MOG contains a single Ig-domain exposed to the extracellular space which allows autoantibodies easy access. MOG protein has been identified as a crucial autoantigen for multiple sclerosis in humans. MOG is capable to produce a demyelinating multiple sclerosis-like disease in experimental animals,namely experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys.
MW :15.31kD.
Recombinant Human Myelin Oligodendrocyte Glycoprotein is produced by our Mammalian expression system and the target gene encoding Gly30-Gly154 is expressed with a 6His tag at the C-terminus. Myelin Oligodendrocyte Glycoprotein (MOG) is a transmembrane protein, which is expressed exclusively in the CNS. MOG contains a single Ig-domain exposed to the extracellular space which allows autoantibodies easy access. MOG protein has been identified as a crucial autoantigen for multiple sclerosis in humans. MOG is capable to produce a demyelinating multiple sclerosis-like disease in experimental animals,namely experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes. |
| BioGrid: | 110482. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
