Recombinant Human Motilin (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAKVDHHHHHH |
Source: Human Cells.
MW :11.4kD.
Recombinant Human Motilin is produced by our Mammalian expression system and the target gene encoding Phe26-Lys115 is expressed with a 6His tag at the C-terminus. Promotilin is a 115 amino acids protein that belongs to the motilin family. It is a secreted protein that plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
MW :11.4kD.
Recombinant Human Motilin is produced by our Mammalian expression system and the target gene encoding Phe26-Lys115 is expressed with a 6His tag at the C-terminus. Promotilin is a 115 amino acids protein that belongs to the motilin family. It is a secreted protein that plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
