Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 a/MAP1LC3A (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH |
Source: E. coli.
MW :15.3kD.
Recombinant Human MAP1LC3A is produced by our E.coli expression system and the target gene encoding Met1-Phe121 is expressed with a 6His tag at the C-terminus. Microtubule-Associated Proteins 1A/1B Light Chain 3A (MAP1LC3A) belongs to the MAP1 LC3 family. MAP1LC3A is found most abundantly in the heart, brain, liver, skeletal muscle, and testis. But it is absent in the thymus and peripheral blood leukocytes. MAP1LC3A is thought to take part in the formation of autophagosomal vacuoles and is one of the light chain subunits that functions together with both MAP1A and/or MAP1B. In addition, MAP1A has an important part in neuronal development and in maintaining the balance between neuronal plasticity and rigidity.
MW :15.3kD.
Recombinant Human MAP1LC3A is produced by our E.coli expression system and the target gene encoding Met1-Phe121 is expressed with a 6His tag at the C-terminus. Microtubule-Associated Proteins 1A/1B Light Chain 3A (MAP1LC3A) belongs to the MAP1 LC3 family. MAP1LC3A is found most abundantly in the heart, brain, liver, skeletal muscle, and testis. But it is absent in the thymus and peripheral blood leukocytes. MAP1LC3A is thought to take part in the formation of autophagosomal vacuoles and is one of the light chain subunits that functions together with both MAP1A and/or MAP1B. In addition, MAP1A has an important part in neuronal development and in maintaining the balance between neuronal plasticity and rigidity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cytoplasm, Endomembrane system, Cytoplasmic vesicle, Cytoplasmic vesicle |
Post transnational modification: | Phosphorylation at Ser-12 by PKA inhibits conjugation to phosphatidylethanolamine (PE). Interaction with MAPK15 reduces the inhibitory phosphorylation and increases autophagy activity. |
Tissue Specificity: | Most abundant in heart, brain, liver, skeletal muscle and testis but absent in thymus and peripheral blood leukocytes. |
BioGrid: | 124137. 121 interactions. |
There are currently no product reviews
|