Recombinant Human Low-Density Lipoprotein Receptor/LDLR (C-6His/AVI)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRGLNDIFEAQKIEWHELENLYFQGHHHHHH |
Source: Human Cells.
MW :90.1kD.
Recombinant Human LDL Receptor is produced by our Mammalian expression system and the target gene encoding Ala22-Arg788 is expressed with a AVI, 6His tag at the C-terminus. Low-density lipoprotein receptor 9 (LDL receptor) is a single-pass type I membrane protein which belongs to the LDLR family. It contains 3 EGF-like domains, 7 LDL-receptor class A domains, and 6 LDL-receptor class B repeats. This protein binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. In case of HIV-1 infection, it functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells. Defects in LDLR will result in familial hypercholesterolemia.
MW :90.1kD.
Recombinant Human LDL Receptor is produced by our Mammalian expression system and the target gene encoding Ala22-Arg788 is expressed with a AVI, 6His tag at the C-terminus. Low-density lipoprotein receptor 9 (LDL receptor) is a single-pass type I membrane protein which belongs to the LDLR family. It contains 3 EGF-like domains, 7 LDL-receptor class A domains, and 6 LDL-receptor class B repeats. This protein binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. In case of HIV-1 infection, it functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells. Defects in LDLR will result in familial hypercholesterolemia.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cell membrane, Membrane, Golgi apparatus, Early endosome, Late endosome, Lysosome |
Post transnational modification: | Ubiquitinated by MYLIP leading to degradation. |
BioGrid: | 110141. 42 interactions. |
There are currently no product reviews
|