Recombinant Human LIM and Cysteine-Rich Domains Protein 1/LMCD1/Dyxin (N, C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRSLEHHHHHH |
Source: E. coli.
MW :44kD.
Recombinant Human LMCD1 is produced by our E.coli expression system and the target gene encoding Met1-Ser365 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. LMCD1 is transcriptional cofactor which contains a cysteine-rich domain in the N-terminal region and 2 LIM domains in the C-terminal region. It also has several potential phosphorylation and N-myristoylation sites and a single potential N-glycosylation site. LMCD1 is expressed in many tissues with highest abundance in skeletal muscle. LMCD1 restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. It plays a critical role in the development of cardiac hypertrophy via activation of calcineurin/nuclear factor of activated T-cells signaling pathway.
MW :44kD.
Recombinant Human LMCD1 is produced by our E.coli expression system and the target gene encoding Met1-Ser365 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. LMCD1 is transcriptional cofactor which contains a cysteine-rich domain in the N-terminal region and 2 LIM domains in the C-terminal region. It also has several potential phosphorylation and N-myristoylation sites and a single potential N-glycosylation site. LMCD1 is expressed in many tissues with highest abundance in skeletal muscle. LMCD1 restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. It plays a critical role in the development of cardiac hypertrophy via activation of calcineurin/nuclear factor of activated T-cells signaling pathway.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus |
| Tissue Specificity: | Expressed in the heart (at protein level). Expressed in many tissues with highest abundance in skeletal muscle. |
| BioGrid: | 119020. 8 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
