Recombinant Human Leydig Insulin-Like 3/INSL3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPYVDHHHHHH |
Source: Human Cells.
MW :13.4kD.
Recombinant Human Insulin-like 3 is produced by our Mammalian expression system and the target gene encoding Leu21-Tyr131 is expressed with a 6His tag at the C-terminus. Insulin-like 3 is a protein that in humans is encoded by the INSL3 gene. It is a secreted protein that belongs to the insulin family. It is expressed in prenatal and postnatal Leydig cells and found as well in the corpus luteum, trophoblast, fetal membranes and breast. It may act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent.It is a ligand for LGR8 receptor.
MW :13.4kD.
Recombinant Human Insulin-like 3 is produced by our Mammalian expression system and the target gene encoding Leu21-Tyr131 is expressed with a 6His tag at the C-terminus. Insulin-like 3 is a protein that in humans is encoded by the INSL3 gene. It is a secreted protein that belongs to the insulin family. It is expressed in prenatal and postnatal Leydig cells and found as well in the corpus luteum, trophoblast, fetal membranes and breast. It may act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent.It is a ligand for LGR8 receptor.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed in prenatal and postnatal Leydig cells. Found as well in the corpus luteum, trophoblast, fetal membranes and breast. |
| BioGrid: | 109851. 9 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
