Recombinant Human Leukocyte Mono Ig-Like Receptor 1/LMIR1/CD300a (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQVDHHHHHH |
Source: Human Cells.
MW :18.48kD.
Recombinant Human LMIR1 is produced by our Mammalian expression system and the target gene encoding Leu18-Gln178 is expressed with a 6His tag at the C-terminus. CD300A is a single-pass type I membrane protein that belongs to the CD300 family. CD300A consists of a 163 amino acid (aa) extracellular domain (ECD) with one Ig-like V- type domain, a 21 amino acid transmembrane segment, and a 98 amino acid cytoplasmic domain with tyrosine residues. CD300A is expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes. CD300A is an inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation.
MW :18.48kD.
Recombinant Human LMIR1 is produced by our Mammalian expression system and the target gene encoding Leu18-Gln178 is expressed with a 6His tag at the C-terminus. CD300A is a single-pass type I membrane protein that belongs to the CD300 family. CD300A consists of a 163 amino acid (aa) extracellular domain (ECD) with one Ig-like V- type domain, a 21 amino acid transmembrane segment, and a 98 amino acid cytoplasmic domain with tyrosine residues. CD300A is expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes. CD300A is an inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes. |
| BioGrid: | 116445. 2 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
