Recombinant Human Leukocyte Ig-Like Receptor B1/LILRB1/ILT2/CD85j (C-6His)(Discontinued)

Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHVDHHHHHH |
Source: Human Cells.
MW :48.24kD.
Recombinant Human LILRB1 is produced by our Mammalian expression system and the target gene encoding Gly24-His458 is expressed with a 6His tag at the C-terminus. The immunoglobulin-like transcript (ILT) family (also named leukocyte Ig-like receptors (LIR) and monocyte/macrophage Ig-like receptors (MIR)) can be activating and inhibitory immunoreceptors. ILTs are expressed on many leukocyte subsets and regulators of immune responses . ILTs share significant homology with killer cell Ig-like receptors (KIR). Except ILT-6, all ILT family members are type I transmembrane proteins having two or four extracellular Ig-like domains . ILT2 is expressed on most monocytes,dendritic cells,and mature B cells. ILT2 is also expressed on small percentages of T-cells and NK cells. ILT2 can prevents cellular activation.
MW :48.24kD.
Recombinant Human LILRB1 is produced by our Mammalian expression system and the target gene encoding Gly24-His458 is expressed with a 6His tag at the C-terminus. The immunoglobulin-like transcript (ILT) family (also named leukocyte Ig-like receptors (LIR) and monocyte/macrophage Ig-like receptors (MIR)) can be activating and inhibitory immunoreceptors. ILTs are expressed on many leukocyte subsets and regulators of immune responses . ILTs share significant homology with killer cell Ig-like receptors (KIR). Except ILT-6, all ILT family members are type I transmembrane proteins having two or four extracellular Ig-like domains . ILT2 is expressed on most monocytes,dendritic cells,and mature B cells. ILT2 is also expressed on small percentages of T-cells and NK cells. ILT2 can prevents cellular activation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | Phosphorylated on tyrosine residues. Dephosphorylated by PTPN6. |
Tissue Specificity: | Expressed predominantly on B-cells and monocytes, and at lower levels on dendritic cells. Detected on a low percentage of T-cells and natural killer (NK) cells. |
BioGrid: | 116070. 7 interactions. |
There are currently no product reviews
|