Recombinant Human Leukocyte Ig-Like Receptor A2/LILRA2/ILT1/CD85h (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASVDHHHHHH |
Source: Human Cells.
MW :44.8kD.
Recombinant Human LILRA2 is produced by our Mammalian expression system and the target gene encoding Gly24-Ser420 is expressed with a 6His tag at the C-terminus. Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 (LILRA2) is a single-pass type I membrane protein. LILRA2 is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. LILRA2 contains four Ig-like C2-type domains, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. LILRA2 does not bind class I MHC antigens.
MW :44.8kD.
Recombinant Human LILRA2 is produced by our Mammalian expression system and the target gene encoding Gly24-Ser420 is expressed with a 6His tag at the C-terminus. Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 (LILRA2) is a single-pass type I membrane protein. LILRA2 is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. LILRA2 contains four Ig-like C2-type domains, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. LILRA2 does not bind class I MHC antigens.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Detected on the surface of all peripheral blood monocytes, neutrophils, basophils and eosinophils (at protein level) (PubMed:12529506, PubMed:22479404). Expression levels are very low or not detectable on monocytes, T-cells, B-cells, dendritic cells and natural killer (NK) cells (PubMed:9548455). |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
