Recombinant Human Leucine-Rich Repeat-Containing Protein 25/LRRC25 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHHHHH |
Source: Human Cells.
MW :16.7kD.
Recombinant Human LRRC25 is produced by our Mammalian expression system and the target gene encoding Leu21-Thr165 is expressed with a 6His tag at the C-terminus. Leucine-rich repeat-containing protein 25(LRRC25) is a single-pass type I membrane protein and contains 3 LRR (leucine-rich) repeats. The protein expressed in plasmacytoid dendritic cells (PDC), monocyte-derived dendritic cells (MDDC), granulocytes, monocytes, B-lymphocytes, peripheral blood leukocytes, spleen, bone marrow, and, to a lesser extent, lymph nodes, fetal liver, and appendix but not in thymus. The protein may be involved in the activation of cells of innate and acquired immunity.
MW :16.7kD.
Recombinant Human LRRC25 is produced by our Mammalian expression system and the target gene encoding Leu21-Thr165 is expressed with a 6His tag at the C-terminus. Leucine-rich repeat-containing protein 25(LRRC25) is a single-pass type I membrane protein and contains 3 LRR (leucine-rich) repeats. The protein expressed in plasmacytoid dendritic cells (PDC), monocyte-derived dendritic cells (MDDC), granulocytes, monocytes, B-lymphocytes, peripheral blood leukocytes, spleen, bone marrow, and, to a lesser extent, lymph nodes, fetal liver, and appendix but not in thymus. The protein may be involved in the activation of cells of innate and acquired immunity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Expressed in plasmacytoid dendritic cells (PDC), monocyte-derived dendritic cells (MDDC), granulocytes, monocytes, B-lymphocytes, peripheral blood leukocytes, spleen, bone marrow, and, to a lesser extent, lymph nodes, fetal liver, and appendix but not in thymus. |
| BioGrid: | 125983. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
