Recombinant Human Lacritin/LACRT (N-6His)
Figure: Coomassie gel staining. LACRT protein (10ug) was loaded in 4-20% SDS Page gel in reducing condition.
Roll over image to zoom in
Shipping Info:
Order now and get it on Tuesday November 12, 2024
Same day delivery FREE on San Diego area orders placed by 1.00 PM
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA sequence : | Recombinant Human Lacritin is produced by our E.coli expression system and the target gene encoding Ala19-Ala138 is expressed with a 6His tag at the N-terminus. MHHHHHHASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA |
| Uniprot ID : | Q9GZZ8 |
| Alternative Name : | Extracellular Glycoprotein Lacritin, LACRT |
Source : E. coli
Extracellular glycoprotein lacritin (Lacritin) is a secreted protein which consists of 119 amino acids after cleavage of the N-terminal signal peptide and displays several predicted alpha helices, mostly in the C- terminal half. Lacritin is highly expressed in the lacrimal gland, localizes primarily to secretory granules and secretory fluid. Lacritin modulates lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium. Lacritin is thus a multifunctional prosecretory mitogen with cell survival activity. Natural or bacterial cleavage of lacritin releases a C-terminal fragment that is bactericidal. Lacritin cell targeting is dependent on the cell surface heparan sulfate proteoglycan syndecan-1 (SDC1). Binding utilizes an enzyme-regulated 'off-on' switch in which active epithelial heparanase (HPSE) cleaves off heparan sulfate to expose a binding site in the N-terminal region of syndecan-1's core protein.
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
