Recombinant Human Krueppel-Like Factor 6/KLF6
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS |
Source: E. coli.
MW :12.6kD.
Recombinant Human Krueppel-like factor 6 is produced by our E.coli expression system and the target gene encoding Met1-Ser109 is expressed. Krueppel-Like Factor 6 (KLF6) belongs to the krueppel C2H2-type zinc-finger protein family. KLF6 contains three C2H2-type zinc fingers and localizes in the nucleus. KLF6 expression is highest in the placenta followed by spleen, thymus, prostate, testis, small intestinem and colon. However, it is weakly expressed in the pancreas, lung, liver, heart, and skeletal muscle. KLF6 functions as a transcriptional activator and could play a role in B-cell growth and development. Defects in KLF6 will result in gastric cancer and prostate cancer.
MW :12.6kD.
Recombinant Human Krueppel-like factor 6 is produced by our E.coli expression system and the target gene encoding Met1-Ser109 is expressed. Krueppel-Like Factor 6 (KLF6) belongs to the krueppel C2H2-type zinc-finger protein family. KLF6 contains three C2H2-type zinc fingers and localizes in the nucleus. KLF6 expression is highest in the placenta followed by spleen, thymus, prostate, testis, small intestinem and colon. However, it is weakly expressed in the pancreas, lung, liver, heart, and skeletal muscle. KLF6 functions as a transcriptional activator and could play a role in B-cell growth and development. Defects in KLF6 will result in gastric cancer and prostate cancer.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| Tissue Specificity: | Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus. |
| BioGrid: | 107711. 17 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
