Recombinant Human KIR2DL3/NKAT2/CD158b2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWLSPTEPSSETGNPRHLHHHHHHH |
Source: Human Cells.
MW :25.4kD.
Recombinant Human KIR2DL3 is produced by our Mammalian expression system and the target gene encoding His22-His245 is expressed with a 6His tag at the C-terminus. Killer-Cell Immunoglobulin-Like Receptors (KIRs) are important cells of the immune system. KIRs are a family of Natural Killer (NK) Cells surface glycoproteins. KIRs control the killing function of these cells by interacting with MHC class I molecules. This interaction allows KIRs to identify virally infected cells or tumor cells by the distinctive low level of Class I MHC on their surface. The majority of KIRs are inhibitory, their recognition of MHC suppresses the cytotoxic activity of their NK cell. Only a limited number of KIRs have the capacity to activate cells. KIR2DL3 is an inhibitory Killer Cell Ig-like Receptor. KIR2DL3 recognizes class I MHC molecules (HLA-Cw1, -Cw3, -Cw7, and Cw8). KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.
MW :25.4kD.
Recombinant Human KIR2DL3 is produced by our Mammalian expression system and the target gene encoding His22-His245 is expressed with a 6His tag at the C-terminus. Killer-Cell Immunoglobulin-Like Receptors (KIRs) are important cells of the immune system. KIRs are a family of Natural Killer (NK) Cells surface glycoproteins. KIRs control the killing function of these cells by interacting with MHC class I molecules. This interaction allows KIRs to identify virally infected cells or tumor cells by the distinctive low level of Class I MHC on their surface. The majority of KIRs are inhibitory, their recognition of MHC suppresses the cytotoxic activity of their NK cell. Only a limited number of KIRs have the capacity to activate cells. KIR2DL3 is an inhibitory Killer Cell Ig-like Receptor. KIR2DL3 recognizes class I MHC molecules (HLA-Cw1, -Cw3, -Cw7, and Cw8). KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| BioGrid: | 110005. 2 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
