-->

Recombinant Human Interleukin-28B/IL-28B/IFN-lambda 3

Product code: 32-8911

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $371.00 

  • $565.00 

-->

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Gene : IFNL3
Gene ID : 282617
Uniprot ID : Q8IZI9
Source: Human Cells.
MW :19.6kD.
Recombinant Human Interleukin-28B is produced by our Mammalian expression system and the target gene encoding Val22-Val196 is expressed. Interleukin-28B, also known as Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, IFNL3, IFNL4, ZCYTO22 and IL28B, is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition, IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
BioGrid: 129395. 2 interactions.
There are currently no product reviews

Customers who purchased this product also purchased