Recombinant Human Interleukin-25/IL25/MYDGF (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL |
Source: E. coli.
MW :18kD.
Recombinant Human SF20 is produced by our E.coli expression system and the target gene encoding Ser33-Leu173 is expressed with a 6His tag at the N-terminus. C19orf10 is a secreted protein which belongs to the UPF0556 family. It is expressed in synovial tissue and detected in synovial fluid of patients with arthropaties. C19orf10 plays a role in proliferation of lymphoid cells and is considered an interleukin.
MW :18kD.
Recombinant Human SF20 is produced by our E.coli expression system and the target gene encoding Ser33-Leu173 is expressed with a 6His tag at the N-terminus. C19orf10 is a secreted protein which belongs to the UPF0556 family. It is expressed in synovial tissue and detected in synovial fluid of patients with arthropaties. C19orf10 plays a role in proliferation of lymphoid cells and is considered an interleukin.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Endoplasmic reticulum-Golgi intermediate compartment |
| Tissue Specificity: | Expressed in bone marrow cells (PubMed:25581518). Expressed in synovial tissue. Found in synovial fluid of patients with arthropaties (PubMed:17362502). |
| BioGrid: | 121028. 9 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
