Recombinant Human Interleukin-17A/F Heterodimer/IL-17A & IL-17F (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg (1mg/ml) |
| Content : | Protein in sterile PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% tween-80. |
| Storage condition : | Protein should be stored at -20°C, though stable at room temperature for 3 weeks. Dilute in PBS. |
| AA sequence : | MTSTLPFSPQVSTPRSKFKRISSEFAATMTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMTSTLPFSPQVSTPRSKFKRISSVLSIEFAATMTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQVDHHHHHH |
Source: HEK293.
MW :43.2kD.
Recombinant Human IL-17A &IL-17F Heterodimer is produced by our Mammalian expression system and the target gene encoding Ile20-Ala155&Arg31-Gln163 is expressed with a 6His tag at the C-terminus. The IL-17 family include IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F. The family is comprised of at least six proinflammatory cytokines that share a conserved cysteine-knot structure but diverge at the N-terminus. All members of the IL-17 family have a similar protein structure, with four highly conserved cysteine residues critical to their 3-dimensional shape, yet they have no sequence similarity to any other known cytokines. IL-17 family members are glycoproteins secreted as dimers that induce local cytokine production and recruit granulocytes to sites of inflammation. IL-17 is induced by IL-15 and IL-23, mainly in activated CD4+ T cells distinct from Th1 or Th2 cells. IL-17F is the most homologous to IL-17, but is induced only by IL-23 in activated monocytes.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Found both in glycosylated and nonglycosylated forms. |
| Tissue Specificity: | Restricted to activated memory T-cells. |
| BioGrid: | 109818. 10 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
