Recombinant Human Interferon gamma Receptor 1/IFNGR1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGVDHHHHHH |
Source: Human Cells.
MW :28.7kD.
Recombinant Human Interferon gamma receptor 1 is produced by our Mammalian expression system and the target gene encoding Glu18-Ser245 is expressed with a 6His tag at the C-terminus. Interferon gamma receptor 1(IFNGR1) encoded by the IFNGR1 gene, is a single-pass type 1 membrane protein which belongs to the type II cytokine receptor family. IFNGR1 is phosphorylated at Ser/Thr residues after translation. IFNGR1 is a receptor for interferon gamma, two receptors bind one interferon gama dimer. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
MW :28.7kD.
Recombinant Human Interferon gamma receptor 1 is produced by our Mammalian expression system and the target gene encoding Glu18-Ser245 is expressed with a 6His tag at the C-terminus. Interferon gamma receptor 1(IFNGR1) encoded by the IFNGR1 gene, is a single-pass type 1 membrane protein which belongs to the type II cytokine receptor family. IFNGR1 is phosphorylated at Ser/Thr residues after translation. IFNGR1 is a receptor for interferon gamma, two receptors bind one interferon gama dimer. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated at Ser/Thr residues. |
| BioGrid: | 109681. 31 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
