Recombinant Human Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1/MCL1L (N-6His)(Discontinued)

Product code: 32-8873

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM Tris, 200mM NaCl, 2mM DTT, 20% glycerol, pH8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MNHKVHHHHHHMFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
Gene : MCL1
Gene ID : 4170
Uniprot ID : Q07820
Source: E.coli.
MW :36.5kD.
Recombinant Human Bcl-2-related protein Mcl-1 is produced by our E.coli expression system and the target gene encoding Met1-Gly327 is expressed with a 6His tag at the N-terminus. Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) is a member of the Bcl-2 family. MCL1 takes part in the control of apoptosis against cell existence, and in the preservation of viability but not of proliferation. MCL1 Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. It mediates its effects by interactions with a number of other regulators of apoptosis. Alternative splicing happens at this locus and two transcript variants encoding different isoforms are known. Isoform 1 is the longer gene product and it increases cell existence by inhibiting apoptosis. Isoform 2 is a shorter gene product which indorses apoptosis and is death-inducing.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Membrane, Cytoplasm, Mitochondrion, Nucleus
Post transnational modification: Ubiquitinated. Ubiquitination is induced by phosphorylation at Ser-159.
BioGrid: 110338. 79 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products