Recombinant Human IL-20 Receptor Subunit a a/IL20RA (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4 . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :26.3kD.
Recombinant Human IL-20 Receptor alpha is produced by our Mammalian expression system and the target gene encoding Val30-Lys250 is expressed with a Fc tag at the C-terminus. Interleukin-20 Receptor Subunit a (IL20RA) is a single-pass type I membrane protein that is a member of the type II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29 amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24 amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed with highest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, and the complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique and specific receptor IL10RB and functions as the receptor for IL26.
MW :26.3kD.
Recombinant Human IL-20 Receptor alpha is produced by our Mammalian expression system and the target gene encoding Val30-Lys250 is expressed with a Fc tag at the C-terminus. Interleukin-20 Receptor Subunit a (IL20RA) is a single-pass type I membrane protein that is a member of the type II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29 amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24 amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed with highest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, and the complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique and specific receptor IL10RB and functions as the receptor for IL26.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin. |
| BioGrid: | 119804. 36 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
