Recombinant Human IL-2 Receptor Subunit gamma /IL-2RG/CD132 (C-Fc-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4 . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVDHHHHHH |
Source: Human Cells.
MW :29.3kD.
Recombinant Human Cytokine receptor common subunit gamma is produced by our Mammalian expression system and the target gene encoding Leu23-Ala262 is expressed with a 6His tag at the C-terminus. IL2RG contains one fibronectin type-III domain. IL2RG is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. IL2RG interacts with SHB upon interleukin stimulation and HTLV-1 accessory protein p12I. Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) and severe combined immunodeficiency X-linked T-cell-negative /B-cell-positive / NK-cell-negative (XSCID).
MW :29.3kD.
Recombinant Human Cytokine receptor common subunit gamma is produced by our Mammalian expression system and the target gene encoding Leu23-Ala262 is expressed with a 6His tag at the C-terminus. IL2RG contains one fibronectin type-III domain. IL2RG is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. IL2RG interacts with SHB upon interleukin stimulation and HTLV-1 accessory protein p12I. Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID) and severe combined immunodeficiency X-linked T-cell-negative /B-cell-positive / NK-cell-negative (XSCID).
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| BioGrid: | 109776. 22 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
