Recombinant Human IL-1 Receptor Type 1/IL-1R-1 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human cells.
MW :62.9kD.
Recombinant Human Interleukin-1 receptor type 1/IL-1R-1 is produced by our Mammalian expression system and the target gene encoding Leu18-Thr332 is expressed fused with a Fc tag at the C-terminus. Interleukin 1 receptor, type I (IL-1R1) is an interleukin receptor that belongs to the interleukin-1 receptor family. IL-1R1 is an 80 kDa transmembrane protein that is expressed predominantly by T cells, fibroblasts, and endothelial cells. This gene along with IL1R2, IL1RL2, and IL1RL1 form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. IL-1R1 is an important mediator involved in many cytokine induced immune and inflammatory responses. It binds to interleukin-1 associates with the corecptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. The signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. It also binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor in the presence of IL1a or IL1 beta but not IL1ra, was identified. Recombinant IL1 soluble receptor Type I is a potent antagonist of IL1 action.
MW :62.9kD.
Recombinant Human Interleukin-1 receptor type 1/IL-1R-1 is produced by our Mammalian expression system and the target gene encoding Leu18-Thr332 is expressed fused with a Fc tag at the C-terminus. Interleukin 1 receptor, type I (IL-1R1) is an interleukin receptor that belongs to the interleukin-1 receptor family. IL-1R1 is an 80 kDa transmembrane protein that is expressed predominantly by T cells, fibroblasts, and endothelial cells. This gene along with IL1R2, IL1RL2, and IL1RL1 form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. IL-1R1 is an important mediator involved in many cytokine induced immune and inflammatory responses. It binds to interleukin-1 associates with the corecptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. The signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. It also binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor in the presence of IL1a or IL1 beta but not IL1ra, was identified. Recombinant IL1 soluble receptor Type I is a potent antagonist of IL1 action.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane, Cell membrane, Secreted |
| Post transnational modification: | Rapidly phosphorylated on Tyr-496 in response to IL-1, which creates a SH2 binding site for the PI 3-kinase regulatory subunit PIK3R1. |
| BioGrid: | 109770. 23 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
