Recombinant Human Hippocalcin-Like Protein 1/HPCAL1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
Source: E.coli.
MW :24.5kD.
Recombinant Human Hippocalcin-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Phe193 is expressed with a 6His tag at the N-terminus. Hippocalcin-Like Protein 1 (HPCAL1) is a neuron-specific calcium-binding member of the recoverin family which found in the retina and brain. HPCAL1 contains four EF-hand domains and it is highly similar to human hippocalcin protein. HPCAL1 is involved in the calcium-dependent regulation of rhodopsin phosphorylation. In addition, it may be of relevance for neuronal signalling in the central nervous system.
MW :24.5kD.
Recombinant Human Hippocalcin-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Phe193 is expressed with a 6His tag at the N-terminus. Hippocalcin-Like Protein 1 (HPCAL1) is a neuron-specific calcium-binding member of the recoverin family which found in the retina and brain. HPCAL1 contains four EF-hand domains and it is highly similar to human hippocalcin protein. HPCAL1 is involved in the calcium-dependent regulation of rhodopsin phosphorylation. In addition, it may be of relevance for neuronal signalling in the central nervous system.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| BioGrid: | 109481. 32 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
